PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00846.1.g00300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 460aa    MW: 50972.6 Da    PI: 6.5558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00846.1.g00300.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.2e-17161207148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     +g WT+eEd +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  Zmw_sc00846.1.g00300.1.am.mkhc 161 KGQWTPEEDRKLVKLVEQFGLRKWSCIAQILP-GRVGKQCRERWHNHL 207
                                     799*****************************.*************97 PP

2Myb_DNA-binding52.21.4e-16215255345
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                      W+ eEd  l++a+k+ G++ W+ Ia++++ gRt++++k++w+
  Zmw_sc00846.1.g00300.1.am.mkhc 215 IWSDEEDMVLIQAHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 255
                                     6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.487156211IPR017930Myb domain
SuperFamilySSF466892.84E-31158254IPR009057Homeodomain-like
SMARTSM007171.2E-14160209IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-29162215IPR009057Homeodomain-like
PfamPF139211.2E-17164220No hitNo description
CDDcd001676.25E-15164207No hitNo description
PROSITE profilePS5129419.544212262IPR017930Myb domain
SMARTSM007172.5E-16212260IPR001005SANT/Myb domain
CDDcd001672.32E-13216258No hitNo description
Gene3DG3DSA:1.10.10.603.7E-21216260IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MLYFSPFHEN DAGRQQHCFS IFSRTIYIAA FEISMDFSCF QPHGGSCSHM PFDSCAQPNG  60
RCELHPVDHP FEGSIGECAA AGSAAVSFAT FNDLGHQYYS ERESKRPVVS QVGSYLPLLT  120
PKTEASHLMG CGLGSYEMNG RFVTRSRKAS SNSLKKANVV KGQWTPEEDR KLVKLVEQFG  180
LRKWSCIAQI LPGRVGKQCR ERWHNHLRPN IKKDIWSDEE DMVLIQAHKE VGNKWAEIAK  240
RLPGRTENSI KNHWNATKRR QFARRRSRSS KGPKSGTLLQ SYIKSLGIGP TSRKNVLAAA  300
PLAAQLPPAL PPPSPAFPVP KQAKRDSEHS PLNENNCGEV SLSFEELLAP ICDEFSVDMC  360
DGLFDANDEV FQVCGIDDDF VDMNCIFNHL DYACNSGDHG MDMEMAWDDV DALADCVGLE  420
MESGSSSAAR VETAAQVKKE IDLVEMMAAT TKKSAGAEDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-471592612104C-Myb DNA-Binding Domain
1mse_C3e-471592612104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441884.11e-157hypothetical protein SORBIDRAFT_08g004250
TrEMBLC5YSM11e-157C5YSM1_SORBI; Putative uncharacterized protein Sb08g004250
STRINGSb08g004250.11e-156(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788